Search results for "Video surveillance"

showing 10 items of 12 documents

Restoration of Videos Degraded by Local Isoplanatism Effects in the Near-Infrared Domain

2008

When observing a scene horizontally at a long distance in the near-infrared domain, degradations due to atmospheric turbulence often occur. In our previous work, we presented two hybrid methods to restore videos degraded by such local perturbations. These restoration algorithms take advantages of a space-time Wiener filter and a space-time regularization by the Laplacian operator. Wiener and Laplacian regularization results are mixed differently depending on the distance between the current pixel and the nearest edge point. It was shown that a gradation between Wiener and Laplacian areas improves results quality, so that only the algorithm using a gradation will be used in this article. In …

Computer engineering. Computer hardwareComputer scienceComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISIONRegularization (mathematics)Image (mathematics)Local degradationAdaptive restorationTK7885-7895symbols.namesakeSegmentationComputer visionPixelbusiness.industryWiener filterAtmospheric turbulenceImage and Video ProcessingVideo SurveillanceQA75.5-76.95Video processingElectronic computers. Computer sciencesymbolsGradationComputer Vision and Pattern RecognitionArtificial intelligenceAutomatic segmentationbusinessLaplace operatorSoftwareELCVIA: electronic letters on computer vision and image analysis
researchProduct

BlockSee: Blockchain for IoT video surveillance in smart cities

2018

The growing demand for safety in urban environments is supported by monitoring using video surveillance. The need to analyze multiple video-flows from different cameras deployed around the city by heterogeneous owners introduces vulnerabilities and privacy issues. Video frames, timestamps, and camera settings can be digitally manipulated by malicious users; the positions of cameras, their orientation and their mechanical settings can be physically manipulated. Digital and physical manipulations may have several effects, including the change of the observed scene and the potential violation of neighbors' privacy. To face these risks, we introduce BlockSee, a blockchain-based video surveillan…

Immutabilityblockchain video surveillance privacyBlockchainbusiness.industryPHYSICAL MANIPULATIONSComputer scienceOrientation (computer vision)Settore ING-INF/03 - TelecomunicazioniComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISION020207 software engineeringMonitoring system02 engineering and technologyComputer securitycomputer.software_genreFace (geometry)0202 electrical engineering electronic engineering information engineering020201 artificial intelligence & image processingTimestampInternet of Thingsbusinesscomputer
researchProduct

An Integrated Architecture for Surveillance and Monitoring in an Archaeological Site

2005

This paper describes an on-going work aimed at designing and deploying a system for the surveillance and monitoring of an archaeological site, namely the "Valley of the Temples" in Agrigento, Italy. Given the relevance of the site from an artistical and historical point of view, it is important to protect the monuments from malicious or simply incautious behavior; however, the vastity of the area to be monitored and the vague definition of its boundaries make it unpractical to provide extensive coverage through traditional sensors or similar devices. We describe the design of an architecture for the surveillance of the site and for the monitoring of the visitors' behavior consisting in an i…

Reasoning systemEngineeringVisual sensor networkbusiness.industryVideo surveillanceComputer securitycomputer.software_genreArchaeologyWireless site surveyKey distribution in wireless sensor networksMobile wireless sensor networkRelevance (information retrieval)Architecturebusinesswireless sensor networksWireless sensor networkcomputer
researchProduct

Real-time estimation of geometrical transformation between views in distributed smart-cameras systems

2008

In this paper, we present a method to automatically estimate the geometric relations among the different views of cameras with partially overlapping fields of view in a wireless video-surveillance system. The method uses the locations of the detected moving objects visible at the same time in two or more views. The correspondences among objects are found by comparing their appearance models based on dominant colour descriptors while the geometric transformation are computed iteratively and may be used to solve the consistent labelling problem. As a significant part of the processing is performed on the smart cameras, the method has been conceived by taking into account the limited resources…

Settore ING-INF/05 - Sistemi Di Elaborazione Delle InformazioniComputer sciencebusiness.industryGeometric transformationMotion detectiondistributed video surveillanceObject detectionData modelingTransformation (function)Computer visionSmart cameraArtificial intelligenceImage sensorbusinessHomography (computer vision)2008 Second ACM/IEEE International Conference on Distributed Smart Cameras
researchProduct

Integrating computer vision techniques and wireless sensor networks in video surveillance systems

2008

Nowadays video-surveillance systems are essential tools to monitor sites and to guarantee the safety of people: automatic detection of moving objects in the scene and recognition of dangerous events are particularly interesting. Our project aims to realize tools and techniques for video surveillance systems in outdoor environment to detect people in an automatic real-time way without the direct control of a human operator. The reference framework consists of distributed stationary cameras coordinated with sensor networks. In particular, wireless sensors are used to sense characteristic quantities of the monitored site, such as variations in temperature, humidity, noise, vibrations, and so o…

Settore ING-INF/05 - Sistemi Di Elaborazione Delle InformazioniDistributed video surveillance
researchProduct

Object Matching in Distributed Video Surveillance Systems by LDA-Based Appearance Descriptors

2009

Establishing correspondences among object instances is still challenging in multi-camera surveillance systems, especially when the cameras’ fields of view are non-overlapping. Spatiotemporal constraints can help in solving the correspondence problem but still leave a wide margin of uncertainty. One way to reduce this uncertainty is to use ap- pearance information about the moving objects in the site. In this paper we present the preliminary results of a new method that can capture salient appearance characteristics at each camera node in the network. A Latent Dirichlet Allocation (LDA) model is created and maintained at each node in the camera network. Each object is encoded in terms of the…

Settore ING-INF/05 - Sistemi Di Elaborazione Delle InformazioniMatching (statistics)business.industryComputer scienceNode (networking)Video surveillanceObject matchingObject (computer science)Latent Dirichlet allocationsymbols.namesakeSalientMargin (machine learning)symbolsComputer visionArtificial intelligencebusinessCorrespondence problemconsistent labelling
researchProduct

Enabling Technologies on Hybrid Camera Networks for Behavioral Analysis of Unattended Indoor Environments and Their Surroundings

2008

This paper presents a layered network architecture and the enabling technologies for accomplishing vision-based behavioral analysis of unattended environments. Specifically the vision network covers both the attended environment and its surroundings by means of multi-modal cameras. The layer overlooking at the surroundings is laid outdoor and tracks people, monitoring entrance/exit points. It recovers the geometry of the site under surveillance and communicates people positions to a higher level layer. The layer monitoring the unattended environment undertakes similar goals, with the addition of maintaining a global mosaic of the observed scene for further understanding. Moreover, it merges …

Settore ING-INF/05 - Sistemi Di Elaborazione Delle InformazioniNetwork architecturebusiness.industryReliability (computer networking)Computer laboratorydistributed video surveillanceSMART CAMERA NETWORKSBehavioral analysisMULTI-MODAL SENSOR FUSIONECamera networkGeographyHuman–computer interactionmulti-modal surveillance; wireless sensor networksEMBEDDED SMART CAMERASmulti-modal surveillanceMULTI-MODAL SENSOR FUSIONE; SMART CAMERA NETWORKS; EMBEDDED SMART CAMERASComputer visionArtificial intelligenceLayer (object-oriented design)businesswireless sensor networks
researchProduct

Real-Time Object Detection in Embedded Video Surveillance Systems

2008

In this paper we report a new method to detect both moving objects and new stationary objects in video sequences. On the basis of temporal consideration we classify pixels into three classes: background, midground and foreground to distinguish between long-term, medium-term and short-term changes. The algorithm has been implemented on a hardware platform with limited resources and it could be used in a wider system like a wireless sensor networks. Particular care has been put in realizing the algorithm so that the limited available resources are used in an efficient way. Experiments have been conducted on publicly available datasets and performance measures are reported.

Settore ING-INF/05 - Sistemi Di Elaborazione Delle InformazioniPixelBasis (linear algebra)business.industryComputer scienceReal-time computingVideo sequencevideo surveillance embedded systemsObject detectionTerm (time)Statistical classificationComputer visionArtificial intelligencebusinessWireless sensor networkLimited resources2008 Ninth International Workshop on Image Analysis for Multimedia Interactive Services
researchProduct

A Dataset of Annotated Omnidirectional Videos for Distancing Applications

2021

Omnidirectional (or 360°) cameras are acquisition devices that, in the next few years, could have a big impact on video surveillance applications, research, and industry, as they can record a spherical view of a whole environment from every perspective. This paper presents two new contributions to the research community: the CVIP360 dataset, an annotated dataset of 360° videos for distancing applications, and a new method to estimate the distances of objects in a scene from a single 360° image. The CVIP360 dataset includes 16 videos acquired outdoors and indoors, annotated by adding information about the pedestrians in the scene (bounding boxes) and the distances to the camera of some point…

distancingComputer scienceDistancing360°Computer applications to medicine. Medical informaticsComputingMethodologies_IMAGEPROCESSINGANDCOMPUTERVISIONR858-859.7Pedestrianvideo datasetArticleImage (mathematics)Bounding overwatchResearch communityomnidirectional camerasdepth estimationPhotographyRadiology Nuclear Medicine and imagingComputer visionvideo surveillanceElectrical and Electronic EngineeringOmnidirectional antennaTR1-1050360Settore ING-INF/05 - Sistemi Di Elaborazione Delle Informazionispherical imagesbusiness.industryPerspective (graphical)Process (computing)QA75.5-76.95trackingComputer Graphics and Computer-Aided Designequirectangular projectionElectronic computers. Computer sciencepedestrianComputer Vision and Pattern RecognitionArtificial intelligencebusinessJournal of Imaging
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct